PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G0929
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 187aa    MW: 21676.5 Da    PI: 7.7665
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G0929genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.83.6e-1163116558
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                  ++ +r+++NRe+ArrsR RK+++++ L      L + N +    ++ ++ ++ +
  Gh_A01G0929  63 RKRKRMESNRESARRSRMRKQKYLDDLMAQLTLLRKDNNQILTSINFITHHYFN 116
                  5789**********************************9998888877766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.1E-1659123IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.9E-1060138No hitNo description
PROSITE profilePS5021710.10561124IPR004827Basic-leucine zipper domain
PfamPF001702.8E-963115IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.03E-1263116No hitNo description
CDDcd147026.97E-1864114No hitNo description
PROSITE patternPS0003606681IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MSPVVSEILR SGFMINSSLR RRTHLVQSFS VVFLHCGNSN SSGSTLLQIS GSEEDLHQLM  60
NERKRKRMES NRESARRSRM RKQKYLDDLM AQLTLLRKDN NQILTSINFI THHYFNIEAE  120
NSVLRAQLME LSQRLDSLNH ILNYLTDPTL NNGIWVYETE PFETSADSFT NFTLNQPIVA  180
SADIFQY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16283RKRKRMESNRESARRSRMRKQK
27582RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.52670.0boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012466317.14e-99PREDICTED: ocs element-binding factor 1-like
TrEMBLA0A0D2MA611e-133A0A0D2MA61_G
STRINGPOPTR_0005s25290.17e-55(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.17e-44basic leucine-zipper 44